Recombinant Rat GMF-β

Description :
FAQ COA 已发表文献 The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF- is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells. Product Properties Synonyms Glia maturation factor beta, GMF-beta Accession Q63228 GeneID 81661 Source E.coli-derived rat Glia Maturation Factor beta proteinSer2-His142 Molecular Weight Approximately 16.6 kDa. AA Sequence SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEWLREKLGFFH Tag None Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder. Purity > 98 % by SDS-PAGE and HPLC analyses. Biological Activity Data is not available. Endotoxin EUper 1g of the protein by the LAL method. Formulation Lyophilized from a 0.2 m filtered concentrated solution in PBS, pH 7.4. Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20C. Further dilutions should be made in appropriate buffered solutions.